Peptides with differential cytolytic activity from skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae)

J. Michael Conlon; Douglas C. Woodhams; Haider Raza; Laurent Coquet; Jérôme Leprince; Thierry Jouenne; Hubert Vaudry; Louise A. Rollins-Smith

doi:10.1016/j.toxicon.2007.04.017

Peptides with differential cytolytic activity from skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae)

J. Michael Conlon
, Douglas C. Woodhams
, Haider Raza
, Laurent Coquet
, Jérôme Leprince
, Thierry Jouenne
, Hubert Vaudry
, Louise A. Rollins-Smith

School of Biomedical Sciences

Research output: Contribution to journal › Article › peer-review

67 Citations (Scopus)

Abstract

Two peptides with differential cytolytic activity against bacteria, a fungus pathogenic to amphibians, and mammalian cells were isolated from norepinephrine-stimulated skin secretions of the Lemur leaf frog Hylomantis lemur Boulenger, 1882. Dermaseptin-L1 (GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS) was active against the Gram-negative bacterium Escherichia coli (MIC=8 μM) but inactive against the Gram-positive bacterium Staphylococcus aureus. This peptide inhibited growth of zoospores of the chytrid fungus Batrachochytrium dendrobatidis at concentrations above 25 μM but did not completely inhibit growth at 100 μM. Phylloseptin-L1 (LLGMIPLAISAISALSKL.NH₂) was active against S. aureus (MIC=8 μM) but was inactive against E. coli. This peptide also inhibited growth of B. dendrobatidis zoospores at concentrations above 25 μM with complete inhibition at 100 μM. Dermaseptin-L1 showed selective cytolytic activity against HepG2 human hepatoma-derived cells (LC₅₀=45 μM) compared with human erythrocytes (LC₅₀=200 μM) whereas phylloseptin-L1 was approximately equipotent against both HepG2 cells (LC₅₀=35 μM) and erythrocytes (LC₅₀=40 μM).

Original language	English
Pages (from-to)	498-506
Number of pages	9
Journal	Toxicon
Volume	50
Issue number	4
DOIs	https://doi.org/10.1016/j.toxicon.2007.04.017
Publication status	Published (in print/issue) - 15 Sept 2007

Funding

This work was supported by a grant from the Terry Fox Fund for Cancer Research and an Individual Research Grant (01-03-8-11/07) from U.A.E. University to J.M.C. and by NSF Grants DEB-0213851 (subcontract to L.R-S.) and IOB-0520847 to L.R-S. The authors thank Dr. Adrian Eley, Department of Medical Microbiology, U.A.E. University and Laura K. Reinert, Department of Microbiology and Immunology, Vanderbilt University for help with the microbiological assays and Karen Lips, Jamie Voyles, and Roberto Brenes for assistance with field work in Panama. The authors also wish to thank the Smithsonian Institute for Tropical Studies (STRI) and the Panama Autoridad Nacional del Ambiente (ANAM) for logistical assistance in Panama. D. Woodhams was partially supported by an NHBLI Immunology of Blood and Vascular Systems Training Grant (5T32 HL069765-05 (J. Hawiger, P.I.).

Funders	Funder number
5T32 HL069765-05
National Science Foundation	DEB-0213851, IOB-0520847
National Heart, Lung, and Blood Institute (IB – U01-HL100395)	T32HL069765

Keywords

Amphibian
Antimicrobial
Chytrid
Cytolysis
Hepatoma

Access to Document

10.1016/j.toxicon.2007.04.017

Cite this

@article{b7f08b41cbaf4e67a12079eea021a833,

title = "Peptides with differential cytolytic activity from skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae)",

abstract = "Two peptides with differential cytolytic activity against bacteria, a fungus pathogenic to amphibians, and mammalian cells were isolated from norepinephrine-stimulated skin secretions of the Lemur leaf frog Hylomantis lemur Boulenger, 1882. Dermaseptin-L1 (GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS) was active against the Gram-negative bacterium Escherichia coli (MIC=8 μM) but inactive against the Gram-positive bacterium Staphylococcus aureus. This peptide inhibited growth of zoospores of the chytrid fungus Batrachochytrium dendrobatidis at concentrations above 25 μM but did not completely inhibit growth at 100 μM. Phylloseptin-L1 (LLGMIPLAISAISALSKL.NH2) was active against S. aureus (MIC=8 μM) but was inactive against E. coli. This peptide also inhibited growth of B. dendrobatidis zoospores at concentrations above 25 μM with complete inhibition at 100 μM. Dermaseptin-L1 showed selective cytolytic activity against HepG2 human hepatoma-derived cells (LC50=45 μM) compared with human erythrocytes (LC50=200 μM) whereas phylloseptin-L1 was approximately equipotent against both HepG2 cells (LC50=35 μM) and erythrocytes (LC50=40 μM).",

keywords = "Amphibian, Antimicrobial, Chytrid, Cytolysis, Hepatoma",

author = "Conlon, \{J. Michael\} and Woodhams, \{Douglas C.\} and Haider Raza and Laurent Coquet and J{\'e}r{\^o}me Leprince and Thierry Jouenne and Hubert Vaudry and Rollins-Smith, \{Louise A.\}",

year = "2007",

month = sep,

day = "15",

doi = "10.1016/j.toxicon.2007.04.017",

language = "English",

volume = "50",

pages = "498--506",

journal = "Toxicon",

issn = "0041-0101",

publisher = "Elsevier Ltd",

number = "4",

}

TY - JOUR

T1 - Peptides with differential cytolytic activity from skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae)

AU - Conlon, J. Michael

AU - Woodhams, Douglas C.

AU - Raza, Haider

AU - Coquet, Laurent

AU - Leprince, Jérôme

AU - Jouenne, Thierry

AU - Vaudry, Hubert

AU - Rollins-Smith, Louise A.

PY - 2007/9/15

Y1 - 2007/9/15

N2 - Two peptides with differential cytolytic activity against bacteria, a fungus pathogenic to amphibians, and mammalian cells were isolated from norepinephrine-stimulated skin secretions of the Lemur leaf frog Hylomantis lemur Boulenger, 1882. Dermaseptin-L1 (GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS) was active against the Gram-negative bacterium Escherichia coli (MIC=8 μM) but inactive against the Gram-positive bacterium Staphylococcus aureus. This peptide inhibited growth of zoospores of the chytrid fungus Batrachochytrium dendrobatidis at concentrations above 25 μM but did not completely inhibit growth at 100 μM. Phylloseptin-L1 (LLGMIPLAISAISALSKL.NH2) was active against S. aureus (MIC=8 μM) but was inactive against E. coli. This peptide also inhibited growth of B. dendrobatidis zoospores at concentrations above 25 μM with complete inhibition at 100 μM. Dermaseptin-L1 showed selective cytolytic activity against HepG2 human hepatoma-derived cells (LC50=45 μM) compared with human erythrocytes (LC50=200 μM) whereas phylloseptin-L1 was approximately equipotent against both HepG2 cells (LC50=35 μM) and erythrocytes (LC50=40 μM).

AB - Two peptides with differential cytolytic activity against bacteria, a fungus pathogenic to amphibians, and mammalian cells were isolated from norepinephrine-stimulated skin secretions of the Lemur leaf frog Hylomantis lemur Boulenger, 1882. Dermaseptin-L1 (GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS) was active against the Gram-negative bacterium Escherichia coli (MIC=8 μM) but inactive against the Gram-positive bacterium Staphylococcus aureus. This peptide inhibited growth of zoospores of the chytrid fungus Batrachochytrium dendrobatidis at concentrations above 25 μM but did not completely inhibit growth at 100 μM. Phylloseptin-L1 (LLGMIPLAISAISALSKL.NH2) was active against S. aureus (MIC=8 μM) but was inactive against E. coli. This peptide also inhibited growth of B. dendrobatidis zoospores at concentrations above 25 μM with complete inhibition at 100 μM. Dermaseptin-L1 showed selective cytolytic activity against HepG2 human hepatoma-derived cells (LC50=45 μM) compared with human erythrocytes (LC50=200 μM) whereas phylloseptin-L1 was approximately equipotent against both HepG2 cells (LC50=35 μM) and erythrocytes (LC50=40 μM).

KW - Amphibian

KW - Antimicrobial

KW - Chytrid

KW - Cytolysis

KW - Hepatoma

UR - https://www.scopus.com/pages/publications/34548461166

U2 - 10.1016/j.toxicon.2007.04.017

DO - 10.1016/j.toxicon.2007.04.017

M3 - Article

C2 - 17561225

AN - SCOPUS:34548461166

SN - 0041-0101

VL - 50

SP - 498

EP - 506

JO - Toxicon

JF - Toxicon

IS - 4

ER -

Peptides with differential cytolytic activity from skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae)

Abstract

Funding

Keywords

Access to Document

Other files and links

Fingerprint

Cite this