Frog corticotropin-releasing hormone (CRH): Isolation, molecular cloning, and biological activity

Reiko Okada; Yoichi Ito; Miyoko Kaneko; Kazutoshi Yamamoto; Nicolas Chartrel; J. Michael Conlon; Hubert Vaudry; Sakae Kikuyama

doi:10.1196/annals.1327.019

Frog corticotropin-releasing hormone (CRH): Isolation, molecular cloning, and biological activity

Reiko Okada, Yoichi Ito, Miyoko Kaneko, Kazutoshi Yamamoto, Nicolas Chartrel, J. Michael Conlon, Hubert Vaudry, Sakae Kikuyama

School of Biomedical Sciences

Research output: Contribution to journal › Article › peer-review

15 Citations (Scopus)

Abstract

Corticotropin-releasing hormone (CRH) was isolated from the brain of the European green frog, Rana esculenta, by combining HPLC purification with radioimmunoassay (RIA) detection. The amino acid sequence SEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII was identical with the sequence of bullfrog (R. catesbeiana) CRH that was deduced from a cDNA encoding the CRH precursor. Synthetic frog CRH enhanced the release of thyroid-stimulating hormone (TSH) from dispersed bullfrog pituitary cells in a concentration- dependent manner. The TSH-releasing activity of a bullfrog hypothalamic extract was decreased by approximately 45% in the presence of the CRH receptor antagonist, α-helical CRH_9-41, suggesting that CRH is one of the main TSH-releasing factors present in the bullfrog hypothalamus.

Original language	English
Pages (from-to)	150-155
Number of pages	6
Journal	Annals of the New York Academy of Sciences
Volume	1040
DOIs	https://doi.org/10.1196/annals.1327.019
Publication status	Published (in print/issue) - 2005

Keywords

Bullfrog
CRH
TSH
TSH-releasing factor

Access to Document

10.1196/annals.1327.019

Cite this

@article{e2cae4052665473c8a22b1b27f1c17f5,

title = "Frog corticotropin-releasing hormone (CRH): Isolation, molecular cloning, and biological activity",

abstract = "Corticotropin-releasing hormone (CRH) was isolated from the brain of the European green frog, Rana esculenta, by combining HPLC purification with radioimmunoassay (RIA) detection. The amino acid sequence SEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII was identical with the sequence of bullfrog (R. catesbeiana) CRH that was deduced from a cDNA encoding the CRH precursor. Synthetic frog CRH enhanced the release of thyroid-stimulating hormone (TSH) from dispersed bullfrog pituitary cells in a concentration- dependent manner. The TSH-releasing activity of a bullfrog hypothalamic extract was decreased by approximately 45% in the presence of the CRH receptor antagonist, α-helical CRH9-41, suggesting that CRH is one of the main TSH-releasing factors present in the bullfrog hypothalamus.",

keywords = "Bullfrog, CRH, TSH, TSH-releasing factor",

author = "Reiko Okada and Yoichi Ito and Miyoko Kaneko and Kazutoshi Yamamoto and Nicolas Chartrel and Conlon, {J. Michael} and Hubert Vaudry and Sakae Kikuyama",

year = "2005",

doi = "10.1196/annals.1327.019",

language = "English",

volume = "1040",

pages = "150--155",

journal = "Annals of the New York Academy of Sciences",

issn = "0077-8923",

publisher = "Wiley-Blackwell",

}

TY - JOUR

T1 - Frog corticotropin-releasing hormone (CRH)

T2 - Isolation, molecular cloning, and biological activity

AU - Okada, Reiko

AU - Ito, Yoichi

AU - Kaneko, Miyoko

AU - Yamamoto, Kazutoshi

AU - Chartrel, Nicolas

AU - Conlon, J. Michael

AU - Vaudry, Hubert

AU - Kikuyama, Sakae

PY - 2005

Y1 - 2005

N2 - Corticotropin-releasing hormone (CRH) was isolated from the brain of the European green frog, Rana esculenta, by combining HPLC purification with radioimmunoassay (RIA) detection. The amino acid sequence SEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII was identical with the sequence of bullfrog (R. catesbeiana) CRH that was deduced from a cDNA encoding the CRH precursor. Synthetic frog CRH enhanced the release of thyroid-stimulating hormone (TSH) from dispersed bullfrog pituitary cells in a concentration- dependent manner. The TSH-releasing activity of a bullfrog hypothalamic extract was decreased by approximately 45% in the presence of the CRH receptor antagonist, α-helical CRH9-41, suggesting that CRH is one of the main TSH-releasing factors present in the bullfrog hypothalamus.

AB - Corticotropin-releasing hormone (CRH) was isolated from the brain of the European green frog, Rana esculenta, by combining HPLC purification with radioimmunoassay (RIA) detection. The amino acid sequence SEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII was identical with the sequence of bullfrog (R. catesbeiana) CRH that was deduced from a cDNA encoding the CRH precursor. Synthetic frog CRH enhanced the release of thyroid-stimulating hormone (TSH) from dispersed bullfrog pituitary cells in a concentration- dependent manner. The TSH-releasing activity of a bullfrog hypothalamic extract was decreased by approximately 45% in the presence of the CRH receptor antagonist, α-helical CRH9-41, suggesting that CRH is one of the main TSH-releasing factors present in the bullfrog hypothalamus.

KW - Bullfrog

KW - CRH

KW - TSH

KW - TSH-releasing factor

UR - http://www.scopus.com/inward/record.url?scp=22144452864&partnerID=8YFLogxK

U2 - 10.1196/annals.1327.019

DO - 10.1196/annals.1327.019

M3 - Article

C2 - 15891019

AN - SCOPUS:22144452864

SN - 0077-8923

VL - 1040

SP - 150

EP - 155

JO - Annals of the New York Academy of Sciences

JF - Annals of the New York Academy of Sciences

ER -

Frog corticotropin-releasing hormone (CRH): Isolation, molecular cloning, and biological activity

Abstract

Keywords

Access to Document

Other files and links

Fingerprint

Cite this