Antimicrobial peptides from the skin of the Tsushima brown frog Rana tsushimensis

J. Michael Conlon; Nadia Al-Ghaferi; Bency Abraham; Agnes Sonnevend; Laurent Coquet; Jérôme Leprince; Thierry Jouenne; Hubert Vaudry; Shawichi Iwamuro

doi:10.1016/j.cbpc.2005.11.022

Antimicrobial peptides from the skin of the Tsushima brown frog Rana tsushimensis

J. Michael Conlon
, Nadia Al-Ghaferi
, Bency Abraham
, Agnes Sonnevend
, Laurent Coquet
, Jérôme Leprince
, Thierry Jouenne
, Hubert Vaudry
, Shawichi Iwamuro

School of Biomedical Sciences

Research output: Contribution to journal › Article › peer-review

40 Citations (Scopus)

Abstract

The Tsushima brown frog Rana tsushimensis Stejneger, 1907 exists in reproductive isolation on the island of Tsushima, Japan. Six peptides with antimicrobial activity were isolated in pure form from an extract of the skin of this species and their amino acid sequences identified them as members of the brevinin-1 (one peptide), brevinin-2 (one peptide) and temporin (four peptides) families. The C-terminally α-amidated brevinin-1 peptide (FLGSIVGALASALPSLISKIRN.NH₂) lacks the cyclic heptapeptide domain Cys¹⁸-(Xaa)₄-Lys-Cys²⁴ at the COOH-terminus of the molecule that characterizes other members of that family. A structurally similar brevinin-1 peptide, also lacking the cyclic domain, was previously isolated from the skin of the Ryukyu brown frog Rana okinavana, indicative of a close phylogenetic relationship between the species. Brevinin-2TSa (GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC) showed broad-spectrum growth inhibitory activity against a range of Gram-negative and Gram-positive bacteria (including methicillin-resistant Staphylococcus aureus) (minimum inhibitory concentrations ≤ 25 μM) and relatively low hemolytic activity against human erythrocytes (LD50 = 100 μM). The peptide therefore represents a candidate for drug development.

Original language	English
Pages (from-to)	42-49
Number of pages	8
Journal	Comparative Biochemistry and Physiology - C Toxicology and Pharmacology
Volume	143
Issue number	1
DOIs	https://doi.org/10.1016/j.cbpc.2005.11.022
Publication status	Published (in print/issue) - May 2006

Funding

This work was supported by an Interdisciplinary Grant (03/12-8-03-01) and a Faculty Support Grant (NP/05/01) from the United Arab Emirates University to JMC and by a grant from the Faculty of Science, Toho University to S. I. We wish to thank Mr. Yasushi Midorikawa for the collection of frogs in Tsushima.

Funders
Toho University
United Arab Emirates University

Keywords

Antimicrobial peptide
Brevinin-1
Brevinin-2
Frog skin
HPLC purification
Temporin

Access to Document

10.1016/j.cbpc.2005.11.022

Cite this

@article{1de53153cc9849cdb5d05152644dfa94,

title = "Antimicrobial peptides from the skin of the Tsushima brown frog Rana tsushimensis",

abstract = "The Tsushima brown frog Rana tsushimensis Stejneger, 1907 exists in reproductive isolation on the island of Tsushima, Japan. Six peptides with antimicrobial activity were isolated in pure form from an extract of the skin of this species and their amino acid sequences identified them as members of the brevinin-1 (one peptide), brevinin-2 (one peptide) and temporin (four peptides) families. The C-terminally α-amidated brevinin-1 peptide (FLGSIVGALASALPSLISKIRN.NH2) lacks the cyclic heptapeptide domain Cys18-(Xaa)4-Lys-Cys24 at the COOH-terminus of the molecule that characterizes other members of that family. A structurally similar brevinin-1 peptide, also lacking the cyclic domain, was previously isolated from the skin of the Ryukyu brown frog Rana okinavana, indicative of a close phylogenetic relationship between the species. Brevinin-2TSa (GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC) showed broad-spectrum growth inhibitory activity against a range of Gram-negative and Gram-positive bacteria (including methicillin-resistant Staphylococcus aureus) (minimum inhibitory concentrations ≤ 25 μM) and relatively low hemolytic activity against human erythrocytes (LD50 = 100 μM). The peptide therefore represents a candidate for drug development.",

keywords = "Antimicrobial peptide, Brevinin-1, Brevinin-2, Frog skin, HPLC purification, Temporin",

author = "Conlon, \{J. Michael\} and Nadia Al-Ghaferi and Bency Abraham and Agnes Sonnevend and Laurent Coquet and J{\'e}r{\^o}me Leprince and Thierry Jouenne and Hubert Vaudry and Shawichi Iwamuro",

year = "2006",

month = may,

doi = "10.1016/j.cbpc.2005.11.022",

language = "English",

volume = "143",

pages = "42--49",

journal = "Comparative Biochemistry and Physiology - C Toxicology and Pharmacology",

issn = "1532-0456",

publisher = "Elsevier Inc.",

number = "1",

}

TY - JOUR

T1 - Antimicrobial peptides from the skin of the Tsushima brown frog Rana tsushimensis

AU - Conlon, J. Michael

AU - Al-Ghaferi, Nadia

AU - Abraham, Bency

AU - Sonnevend, Agnes

AU - Coquet, Laurent

AU - Leprince, Jérôme

AU - Jouenne, Thierry

AU - Vaudry, Hubert

AU - Iwamuro, Shawichi

PY - 2006/5

Y1 - 2006/5

N2 - The Tsushima brown frog Rana tsushimensis Stejneger, 1907 exists in reproductive isolation on the island of Tsushima, Japan. Six peptides with antimicrobial activity were isolated in pure form from an extract of the skin of this species and their amino acid sequences identified them as members of the brevinin-1 (one peptide), brevinin-2 (one peptide) and temporin (four peptides) families. The C-terminally α-amidated brevinin-1 peptide (FLGSIVGALASALPSLISKIRN.NH2) lacks the cyclic heptapeptide domain Cys18-(Xaa)4-Lys-Cys24 at the COOH-terminus of the molecule that characterizes other members of that family. A structurally similar brevinin-1 peptide, also lacking the cyclic domain, was previously isolated from the skin of the Ryukyu brown frog Rana okinavana, indicative of a close phylogenetic relationship between the species. Brevinin-2TSa (GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC) showed broad-spectrum growth inhibitory activity against a range of Gram-negative and Gram-positive bacteria (including methicillin-resistant Staphylococcus aureus) (minimum inhibitory concentrations ≤ 25 μM) and relatively low hemolytic activity against human erythrocytes (LD50 = 100 μM). The peptide therefore represents a candidate for drug development.

AB - The Tsushima brown frog Rana tsushimensis Stejneger, 1907 exists in reproductive isolation on the island of Tsushima, Japan. Six peptides with antimicrobial activity were isolated in pure form from an extract of the skin of this species and their amino acid sequences identified them as members of the brevinin-1 (one peptide), brevinin-2 (one peptide) and temporin (four peptides) families. The C-terminally α-amidated brevinin-1 peptide (FLGSIVGALASALPSLISKIRN.NH2) lacks the cyclic heptapeptide domain Cys18-(Xaa)4-Lys-Cys24 at the COOH-terminus of the molecule that characterizes other members of that family. A structurally similar brevinin-1 peptide, also lacking the cyclic domain, was previously isolated from the skin of the Ryukyu brown frog Rana okinavana, indicative of a close phylogenetic relationship between the species. Brevinin-2TSa (GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC) showed broad-spectrum growth inhibitory activity against a range of Gram-negative and Gram-positive bacteria (including methicillin-resistant Staphylococcus aureus) (minimum inhibitory concentrations ≤ 25 μM) and relatively low hemolytic activity against human erythrocytes (LD50 = 100 μM). The peptide therefore represents a candidate for drug development.

KW - Antimicrobial peptide

KW - Brevinin-1

KW - Brevinin-2

KW - Frog skin

KW - HPLC purification

KW - Temporin

UR - https://www.scopus.com/pages/publications/33645418011

U2 - 10.1016/j.cbpc.2005.11.022

DO - 10.1016/j.cbpc.2005.11.022

M3 - Article

C2 - 16413829

AN - SCOPUS:33645418011

SN - 1532-0456

VL - 143

SP - 42

EP - 49

JO - Comparative Biochemistry and Physiology - C Toxicology and Pharmacology

JF - Comparative Biochemistry and Physiology - C Toxicology and Pharmacology

IS - 1

ER -

Antimicrobial peptides from the skin of the Tsushima brown frog Rana tsushimensis

Abstract

Funding

Keywords

Access to Document

Other files and links

Fingerprint

Cite this